SCOPe 2.08: Domain d1rpka1: 1rpk A:348-404

Lineage for d1rpka1 (1rpk A:348-404)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Plant alpha-amylase [51040] (2 species)
   single beta-sheet; probable result of a decay of the common-fold

7. Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89384] (7 PDB entries)

8. Domain d1rpka1: 1rpk A:348-404 [118787]
   Other proteins in same PDB: d1rpka2
   automated match to d1ht6a1
   complexed with ca
   heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures

Details for d1rpka1

PDB Entry: 1rpk, 2 Å

PDB Description: crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with acarbose

PDB Compounds: (A:) Alpha-amylase type 1 isozyme

SCOPe Domain Sequences for d1rpka1:

Sequence; same for both SEQRES and ATOM records:

>d1rpka1 b.71.1.1 (A:348-404) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]}
itatsalkilmhegdayvaeidgkvvvkigsrydvgavipagfvtsahgndyavwek

Timeline for d1rpka1:

• d1rpka1 first appeared in SCOP 1.73
  
• d1rpka1 appears in SCOPe 2.07