Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Plant alpha-amylase [51040] (2 species) single beta-sheet; probable result of a decay of the common-fold |
Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89384] (7 PDB entries) |
Domain d1rp9a1: 1rp9 A:348-404 [118785] Other proteins in same PDB: d1rp9a2 automated match to d1ht6a1 complexed with ca; mutant |
PDB Entry: 1rp9 (more details), 2 Å
SCOPe Domain Sequences for d1rp9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rp9a1 b.71.1.1 (A:348-404) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} itatsalkilmhegdayvaeidgkvvvkigsrydvgavipagfvtsahgndyavwek
Timeline for d1rp9a1: