Lineage for d1rp8a2 (1rp8 A:1-347)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815286Family c.1.8.1: Amylase, catalytic domain [51446] (25 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 815714Protein Plant alpha-amylase [51474] (2 species)
  7. 815715Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89465] (8 PDB entries)
  8. 815720Domain d1rp8a2: 1rp8 A:1-347 [118784]
    Other proteins in same PDB: d1rp8a1
    automatically matched to d1ht6a2
    complexed with bgc, ca, glc; mutant

Details for d1rp8a2

PDB Entry: 1rp8 (more details), 2 Å

PDB Description: crystal structure of barley alpha-amylase isozyme 1 (amy1) inactive mutant d180a in complex with maltoheptaose
PDB Compounds: (A:) Alpha-amylase type 1 isozyme

SCOP Domain Sequences for d1rp8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rp8a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]}
hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrla
fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrng

SCOP Domain Coordinates for d1rp8a2:

Click to download the PDB-style file with coordinates for d1rp8a2.
(The format of our PDB-style files is described here.)

Timeline for d1rp8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rp8a1