SCOPe 2.05: Domain d1rm1b2: 1rm1 B:55-120

Lineage for d1rm1b2 (1rm1 B:55-120)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.56: Transcription factor IIA (TFIIA), beta-barrel domain [50783] (1 superfamily)
   barrel, closed; n=6, S=12; mixed beta-sheet

4. Superfamily b.56.1: Transcription factor IIA (TFIIA), beta-barrel domain [50784] (1 family)
   dimer of non-identical beta-sheet domains

5. Family b.56.1.1: Transcription factor IIA (TFIIA), beta-barrel domain [50785] (2 proteins)
   heterodimer of two homologous chains

6. Protein Small chain TOA2, C-terminal domain [88686] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88687] (3 PDB entries)

8. Domain d1rm1b2: 1rm1 B:55-120 [118781]
   Other proteins in same PDB: d1rm1a1, d1rm1a2, d1rm1b1
   protein/DNA complex

Details for d1rm1b2

PDB Entry: 1rm1, 2.5 Å

PDB Description: structure of a yeast tfiia/tbp/tata-box dna complex

PDB Compounds: (B:) Transcription initiation factor IIA small chain

SCOPe Domain Sequences for d1rm1b2:

Sequence, based on SEQRES records:

>d1rm1b2 b.56.1.1 (B:55-120) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntqskltvkgnldtygfcddvwtfivkncqvtvedshrdasqngsgdsqsvisvdklriv
acnskk

Sequence, based on observed residues (ATOM records):

>d1rm1b2 b.56.1.1 (B:55-120) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntqskltvkgnldtygfcddvwtfivkncqvtvevisvdklrivacnskk

Timeline for d1rm1b2:

• d1rm1b2 first appeared in SCOP 1.73
  
• d1rm1b2 appears in SCOPe 2.04
  
• d1rm1b2 appears in SCOPe 2.06
  
• d1rm1b2 appears in the current release, SCOPe 2.08