Lineage for d1rm1b2 (1rm1 B:55-120)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395139Fold b.56: Transcription factor IIA (TFIIA), beta-barrel domain [50783] (1 superfamily)
    barrel, closed; n=6, S=12; mixed beta-sheet
  4. 2395140Superfamily b.56.1: Transcription factor IIA (TFIIA), beta-barrel domain [50784] (1 family) (S)
    dimer of non-identical beta-sheet domains
  5. 2395141Family b.56.1.1: Transcription factor IIA (TFIIA), beta-barrel domain [50785] (2 protein domains)
    heterodimer of two homologous chains
  6. 2395148Protein Small chain TOA2, C-terminal domain [88686] (2 species)
  7. 2395149Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88687] (3 PDB entries)
  8. 2395151Domain d1rm1b2: 1rm1 B:55-120 [118781]
    Other proteins in same PDB: d1rm1a1, d1rm1a2, d1rm1b1
    protein/DNA complex

Details for d1rm1b2

PDB Entry: 1rm1 (more details), 2.5 Å

PDB Description: structure of a yeast tfiia/tbp/tata-box dna complex
PDB Compounds: (B:) Transcription initiation factor IIA small chain

SCOPe Domain Sequences for d1rm1b2:

Sequence, based on SEQRES records: (download)

>d1rm1b2 b.56.1.1 (B:55-120) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntqskltvkgnldtygfcddvwtfivkncqvtvedshrdasqngsgdsqsvisvdklriv
acnskk

Sequence, based on observed residues (ATOM records): (download)

>d1rm1b2 b.56.1.1 (B:55-120) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntqskltvkgnldtygfcddvwtfivkncqvtvevisvdklrivacnskk

SCOPe Domain Coordinates for d1rm1b2:

Click to download the PDB-style file with coordinates for d1rm1b2.
(The format of our PDB-style files is described here.)

Timeline for d1rm1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rm1b1