Lineage for d1rm1b1 (1rm1 B:4-54)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995616Fold a.32: Transcription factor IIA (TFIIA), alpha-helical domain [47395] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 1995617Superfamily a.32.1: Transcription factor IIA (TFIIA), alpha-helical domain [47396] (1 family) (S)
    dimer of non-identical alpha-hairpins
  5. 1995618Family a.32.1.1: Transcription factor IIA (TFIIA), alpha-helical domain [47397] (2 proteins)
    heterodimer of two homologous chains
  6. 1995625Protein Small chain TOA2, N-terminal domain [88835] (2 species)
  7. 1995626Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88836] (3 PDB entries)
  8. 1995628Domain d1rm1b1: 1rm1 B:4-54 [118780]
    Other proteins in same PDB: d1rm1a1, d1rm1a2, d1rm1b2
    automated match to d1nh2d1
    protein/DNA complex

Details for d1rm1b1

PDB Entry: 1rm1 (more details), 2.5 Å

PDB Description: structure of a yeast tfiia/tbp/tata-box dna complex
PDB Compounds: (B:) Transcription initiation factor IIA small chain

SCOPe Domain Sequences for d1rm1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm1b1 a.32.1.1 (B:4-54) Small chain TOA2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pgyyelyrrstignslvdaldtlisdgrieaslamrvletfdkvvaetlkd

SCOPe Domain Coordinates for d1rm1b1:

Click to download the PDB-style file with coordinates for d1rm1b1.
(The format of our PDB-style files is described here.)

Timeline for d1rm1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rm1b2