SCOPe 2.08: Domain d1rm1b1: 1rm1 B:4-54

Lineage for d1rm1b1 (1rm1 B:4-54)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.32: Transcription factor IIA (TFIIA), alpha-helical domain [47395] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.32.1: Transcription factor IIA (TFIIA), alpha-helical domain [47396] (1 family)
   dimer of non-identical alpha-hairpins

5. Family a.32.1.1: Transcription factor IIA (TFIIA), alpha-helical domain [47397] (2 proteins)
   heterodimer of two homologous chains

6. Protein Small chain TOA2, N-terminal domain [88835] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88836] (3 PDB entries)

8. Domain d1rm1b1: 1rm1 B:4-54 [118780]
   Other proteins in same PDB: d1rm1a1, d1rm1a2, d1rm1b2
   automated match to d1nh2d1
   protein/DNA complex

Details for d1rm1b1

PDB Entry: 1rm1, 2.5 Å

PDB Description: structure of a yeast tfiia/tbp/tata-box dna complex

PDB Compounds: (B:) Transcription initiation factor IIA small chain

SCOPe Domain Sequences for d1rm1b1:

Sequence; same for both SEQRES and ATOM records:

>d1rm1b1 a.32.1.1 (B:4-54) Small chain TOA2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pgyyelyrrstignslvdaldtlisdgrieaslamrvletfdkvvaetlkd

Timeline for d1rm1b1:

• d1rm1b1 first appeared in SCOP 1.73
  
• d1rm1b1 appears in SCOPe 2.07