SCOPe 2.06: Domain d1rm1a2: 1rm1 A:149-240

Lineage for d1rm1a2 (1rm1 A:149-240)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats
   automatically mapped to Pfam PF00352

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
   structure of the N-terminal domain is not known yet

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries)

8. Domain d1rm1a2: 1rm1 A:149-240 [118779]
   Other proteins in same PDB: d1rm1b1, d1rm1b2
   automated match to d1mp9b2
   protein/DNA complex

Details for d1rm1a2

PDB Entry: 1rm1, 2.5 Å

PDB Description: structure of a yeast tfiia/tbp/tata-box dna complex

PDB Compounds: (A:) TATA-box binding protein

SCOPe Domain Sequences for d1rm1a2:

Sequence; same for both SEQRES and ATOM records:

>d1rm1a2 d.129.1.1 (A:149-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aakftdfkiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifv
sgkivltgakqreeiyqafeaiypvlsefrkm

Timeline for d1rm1a2:

• d1rm1a2 first appeared in SCOP 1.73
  
• d1rm1a2 appears in SCOPe 2.05
  
• d1rm1a2 appears in SCOPe 2.07
  
• d1rm1a2 appears in the current release, SCOPe 2.08