Lineage for d1rm1a2 (1rm1 A:149-240)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975209Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2975210Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 2975211Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 2975212Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries)
  8. 2975220Domain d1rm1a2: 1rm1 A:149-240 [118779]
    Other proteins in same PDB: d1rm1b1, d1rm1b2
    automated match to d1mp9b2
    protein/DNA complex

Details for d1rm1a2

PDB Entry: 1rm1 (more details), 2.5 Å

PDB Description: structure of a yeast tfiia/tbp/tata-box dna complex
PDB Compounds: (A:) TATA-box binding protein

SCOPe Domain Sequences for d1rm1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm1a2 d.129.1.1 (A:149-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aakftdfkiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifv
sgkivltgakqreeiyqafeaiypvlsefrkm

SCOPe Domain Coordinates for d1rm1a2:

Click to download the PDB-style file with coordinates for d1rm1a2.
(The format of our PDB-style files is described here.)

Timeline for d1rm1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rm1a1