![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.129: TBP-like [55944] (10 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) ![]() |
![]() | Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats |
![]() | Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries) |
![]() | Domain d1rm1a1: 1rm1 A:61-155 [118778] Other proteins in same PDB: d1rm1b1, d1rm1b2 automatically matched to d1ngma1 |
PDB Entry: 1rm1 (more details), 2.5 Å
SCOP Domain Sequences for d1rm1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rm1a1 d.129.1.1 (A:61-155) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk mvvtgakseddsklasrkyariiqkigfaakftdf
Timeline for d1rm1a1: