Lineage for d1rm1a1 (1rm1 A:61-148)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2538747Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2538748Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 2538749Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 2538750Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries)
  8. 2538757Domain d1rm1a1: 1rm1 A:61-148 [118778]
    Other proteins in same PDB: d1rm1b1, d1rm1b2
    automated match to d1mp9b1
    protein/DNA complex

Details for d1rm1a1

PDB Entry: 1rm1 (more details), 2.5 Å

PDB Description: structure of a yeast tfiia/tbp/tata-box dna complex
PDB Compounds: (A:) TATA-box binding protein

SCOPe Domain Sequences for d1rm1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm1a1 d.129.1.1 (A:61-148) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
mvvtgakseddsklasrkyariiqkigf

SCOPe Domain Coordinates for d1rm1a1:

Click to download the PDB-style file with coordinates for d1rm1a1.
(The format of our PDB-style files is described here.)

Timeline for d1rm1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rm1a2