SCOPe 2.08: Domain d1rkib_: 1rki B:

Lineage for d1rkib_ (1rki B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.308: THUMP domain [143436] (1 superfamily)
   contains mixed 8-stranded beta-sheet, folded into a half-barrel and covered with 4 helices on the outside; order 32148756; strands 5, 6 and 7 are parallel

4. Superfamily d.308.1: THUMP domain-like [143437] (3 families)
   predicted RNA-binding function

5. Family d.308.1.2: PAE0736-like [143443] (1 protein)
   orphan protein; rudiment, disulfide-stabilized form of THUMP domain fold
   automatically mapped to Pfam PF11424

6. Protein Hypothetical protein PAE0736 [143444] (1 species)

7. Species Pyrobaculum aerophilum [TaxId:13773] [143445] (1 PDB entry)
   Uniprot Q8ZYK2 1-98

8. Domain d1rkib_: 1rki B: [118777]
   Other proteins in same PDB: d1rkia2
   automated match to d1rkia1
   complexed with act, cl, p6g, pg4, so4

Details for d1rkib_

PDB Entry: 1rki, 1.6 Å

PDB Description: Structure of pag5_736 from P. aerophilum with three disulphide bonds

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d1rkib_:

Sequence; same for both SEQRES and ATOM records:

>d1rkib_ d.308.1.2 (B:) Hypothetical protein PAE0736 {Pyrobaculum aerophilum [TaxId: 13773]}
mkkhiiiktipkkeeiisrdlcdciyyydnsvickpigpskvyvstslenlekclqlhyf
kklvknieifdevhnskpncdkcliveiggvyfvrrv

Timeline for d1rkib_:

• d1rkib_ first appeared in SCOP 1.73, called d1rkib1
  
• d1rkib_ appears in SCOPe 2.07