![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.308: THUMP domain [143436] (1 superfamily) contains mixed 8-stranded beta-sheet, folded into a half-barrel and covered with 4 helices on the outside; order 32148756; strands 5, 6 and 7 are parallel |
![]() | Superfamily d.308.1: THUMP domain-like [143437] (3 families) ![]() predicted RNA-binding function |
![]() | Family d.308.1.2: PAE0736-like [143443] (1 protein) orphan protein; rudiment, disulfide-stabilized form of THUMP domain fold automatically mapped to Pfam PF11424 |
![]() | Protein Hypothetical protein PAE0736 [143444] (1 species) |
![]() | Species Pyrobaculum aerophilum [TaxId:13773] [143445] (1 PDB entry) Uniprot Q8ZYK2 1-98 |
![]() | Domain d1rkib_: 1rki B: [118777] Other proteins in same PDB: d1rkia2 automated match to d1rkia1 complexed with act, cl, p6g, pg4, so4 |
PDB Entry: 1rki (more details), 1.6 Å
SCOPe Domain Sequences for d1rkib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rkib_ d.308.1.2 (B:) Hypothetical protein PAE0736 {Pyrobaculum aerophilum [TaxId: 13773]} mkkhiiiktipkkeeiisrdlcdciyyydnsvickpigpskvyvstslenlekclqlhyf kklvknieifdevhnskpncdkcliveiggvyfvrrv
Timeline for d1rkib_: