Lineage for d1rkib_ (1rki B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2566767Fold d.308: THUMP domain [143436] (1 superfamily)
    contains mixed 8-stranded beta-sheet, folded into a half-barrel and covered with 4 helices on the outside; order 32148756; strands 5, 6 and 7 are parallel
  4. 2566768Superfamily d.308.1: THUMP domain-like [143437] (3 families) (S)
    predicted RNA-binding function
  5. 2566777Family d.308.1.2: PAE0736-like [143443] (1 protein)
    orphan protein; rudiment, disulfide-stabilized form of THUMP domain fold
    automatically mapped to Pfam PF11424
  6. 2566778Protein Hypothetical protein PAE0736 [143444] (1 species)
  7. 2566779Species Pyrobaculum aerophilum [TaxId:13773] [143445] (1 PDB entry)
    Uniprot Q8ZYK2 1-98
  8. 2566781Domain d1rkib_: 1rki B: [118777]
    Other proteins in same PDB: d1rkia2
    automated match to d1rkia1
    complexed with act, cl, p6g, pg4, so4

Details for d1rkib_

PDB Entry: 1rki (more details), 1.6 Å

PDB Description: Structure of pag5_736 from P. aerophilum with three disulphide bonds
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d1rkib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkib_ d.308.1.2 (B:) Hypothetical protein PAE0736 {Pyrobaculum aerophilum [TaxId: 13773]}
mkkhiiiktipkkeeiisrdlcdciyyydnsvickpigpskvyvstslenlekclqlhyf
kklvknieifdevhnskpncdkcliveiggvyfvrrv

SCOPe Domain Coordinates for d1rkib_:

Click to download the PDB-style file with coordinates for d1rkib_.
(The format of our PDB-style files is described here.)

Timeline for d1rkib_: