![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
![]() | Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [53962] (716 PDB entries) Uniprot P00698 |
![]() | Domain d1rjcb_: 1rjc B: [118775] Other proteins in same PDB: d1rjca1 automated match to d3lzta_ complexed with gol, po4 |
PDB Entry: 1rjc (more details), 1.4 Å
SCOPe Domain Sequences for d1rjcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rjcb_ d.2.1.2 (B:) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d1rjcb_: