Lineage for d1rh9a1 (1rh9 A:30-399)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830882Protein Beta-mannanase [51502] (4 species)
  7. 2830889Species Tomato (Lycopersicon esculentum) [TaxId:4081] [141774] (1 PDB entry)
    Uniprot Q93WT4 30-399
  8. 2830890Domain d1rh9a1: 1rh9 A:30-399 [118773]

Details for d1rh9a1

PDB Entry: 1rh9 (more details), 1.5 Å

PDB Description: Family GH5 endo-beta-mannanase from Lycopersicon esculentum (tomato)
PDB Compounds: (A:) endo-beta-mannanase

SCOPe Domain Sequences for d1rh9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]}
nnfvytdgthfalngkslyingfnaywlmyiaydpstrikvtntfqqaskykmnvartwa
fshggsrplqsapgvyneqmfqgldfviseakkygihlimslvnnwdafggkkqyvewav
qrgqkltsdddfftnpmvkgfyknnvkvvltrvntitkvaykddptilswelineprcps
dlsgktfqnwvlemagylksidsnhlleiglegfygndmrqynpnsyifgtnfisnnqvq
gidfttihmypnqwlpgltqeaqdkwasqwiqvhiddskmlkkplliaefgkstktpgyt
vakrdnyfekiygtifncaksggpcggglfwqvlgqgmssfddgyqvvlqespstsrvil
lqslrlskls

SCOPe Domain Coordinates for d1rh9a1:

Click to download the PDB-style file with coordinates for d1rh9a1.
(The format of our PDB-style files is described here.)

Timeline for d1rh9a1: