Lineage for d1rgbl1 (1rgb L:1-133)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733205Species Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor [TaxId:8704] [88517] (5 PDB entries)
  8. 2733214Domain d1rgbl1: 1rgb L:1-133 [118772]
    automatically matched to d1vpi__
    complexed with eld

Details for d1rgbl1

PDB Entry: 1rgb (more details), 3.3 Å

PDB Description: phospholipase a2 from vipera ammodytes meridionalis
PDB Compounds: (L:) phospholipase a2

SCOPe Domain Sequences for d1rgbl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgbl1 a.133.1.2 (L:1-133) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor [TaxId: 8704]}
nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk
laiysysfkkgnivcgknngclrdicecdrvaancfhqnkntynknykflsssrcrqtse
qc

SCOPe Domain Coordinates for d1rgbl1:

Click to download the PDB-style file with coordinates for d1rgbl1.
(The format of our PDB-style files is described here.)

Timeline for d1rgbl1: