Lineage for d1rgbk1 (1rgb K:1-133)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777954Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 777955Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 777960Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 778048Protein Snake phospholipase A2 [48624] (35 species)
  7. 778145Species Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor [TaxId:8704] [88517] (5 PDB entries)
  8. 778153Domain d1rgbk1: 1rgb K:1-133 [118771]
    automatically matched to d1vpi__
    complexed with eld

Details for d1rgbk1

PDB Entry: 1rgb (more details), 3.3 Å

PDB Description: phospholipase a2 from vipera ammodytes meridionalis
PDB Compounds: (K:) phospholipase a2

SCOP Domain Sequences for d1rgbk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgbk1 a.133.1.2 (K:1-133) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor [TaxId: 8704]}
nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk
laiysysfkkgnivcgknngclrdicecdrvaancfhqnkntynknykflsssrcrqtse
qc

SCOP Domain Coordinates for d1rgbk1:

Click to download the PDB-style file with coordinates for d1rgbk1.
(The format of our PDB-style files is described here.)

Timeline for d1rgbk1: