SCOP 1.73: Domain d1rgbb1: 1rgb B:1-133

Lineage for d1rgbb1 (1rgb B:1-133)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor [TaxId:8704] [88517] (5 PDB entries)

8. Domain d1rgbb1: 1rgb B:1-133 [118770]
   automatically matched to d1vpi__
   complexed with eld

Details for d1rgbb1

PDB Entry: 1rgb, 3.3 Å

PDB Description: phospholipase a2 from vipera ammodytes meridionalis

PDB Compounds: (B:) phospholipase a2

SCOP Domain Sequences for d1rgbb1:

Sequence; same for both SEQRES and ATOM records:

>d1rgbb1 a.133.1.2 (B:1-133) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor [TaxId: 8704]}
nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk
laiysysfkkgnivcgknngclrdicecdrvaancfhqnkntynknykflsssrcrqtse
qc

Timeline for d1rgbb1:

• d1rgbb1 is new in SCOP 1.73
  
• d1rgbb1 appears in SCOP 1.75
  
• d1rgbb1 appears in the current release, SCOPe 2.08