| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
| Protein Snake phospholipase A2 [48624] (38 species) |
| Species Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor [TaxId:8704] [88517] (5 PDB entries) |
| Domain d1rgba1: 1rgb A:1-133 [118769] automatically matched to d1vpi__ complexed with eld |
PDB Entry: 1rgb (more details), 3.3 Å
SCOPe Domain Sequences for d1rgba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rgba1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor [TaxId: 8704]}
nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk
laiysysfkkgnivcgknngclrdicecdrvaancfhqnkntynknykflsssrcrqtse
qc
Timeline for d1rgba1: