Lineage for d1rc1b_ (1rc1 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892510Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2892511Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2892512Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 2892519Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)
  7. 2892541Species Human (Homo sapiens) [TaxId:9606] [82468] (30 PDB entries)
  8. 2892578Domain d1rc1b_: 1rc1 B: [118768]
    automated match to d1meoa_
    complexed with kt3, po4

Details for d1rc1b_

PDB Entry: 1rc1 (more details), 2.25 Å

PDB Description: Human GAR Tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
PDB Compounds: (B:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d1rc1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rc1b_ c.65.1.1 (B:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
lqlvasgtvqlgengkicwv

SCOPe Domain Coordinates for d1rc1b_:

Click to download the PDB-style file with coordinates for d1rc1b_.
(The format of our PDB-style files is described here.)

Timeline for d1rc1b_: