SCOP 1.73: Domain d1rbza1: 1rbz A:1-200

Lineage for d1rbza1 (1rbz A:1-200)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (1 family)

5. Family c.65.1.1: Formyltransferase [53329] (4 proteins)

6. Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82468] (12 PDB entries)

8. Domain d1rbza1: 1rbz A:1-200 [118763]
   automatically matched to d1meoa_
   complexed with kt5

Details for d1rbza1

PDB Entry: 1rbz, 2.1 Å

PDB Description: Human GAR Tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid

PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase

SCOP Domain Sequences for d1rbza1:

Sequence; same for both SEQRES and ATOM records:

>d1rbza1 c.65.1.1 (A:1-200) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
lqlvasgtvqlgengkicwv

Timeline for d1rbza1:

• d1rbza1 is new in SCOP 1.73
  
• d1rbza1 appears in SCOP 1.75
  
• d1rbza1 appears in the current release, SCOPe 2.08, called d1rbza_