![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
![]() | Superfamily c.65.1: Formyltransferase [53328] (1 family) ![]() |
![]() | Family c.65.1.1: Formyltransferase [53329] (4 proteins) |
![]() | Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82468] (12 PDB entries) |
![]() | Domain d1rbqd1: 1rbq D:1-200 [118758] automatically matched to d1meoa_ complexed with keu, po4 |
PDB Entry: 1rbq (more details), 2.1 Å
SCOP Domain Sequences for d1rbqd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rbqd1 c.65.1.1 (D:1-200) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]} arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa lqlvasgtvqlgengkicwv
Timeline for d1rbqd1: