SCOPe 2.08: Domain d1r9nd1: 1r9n D:40-508

Lineage for d1r9nd1 (1r9n D:40-508)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82174] (98 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d1r9nd1: 1r9n D:40-508 [118751]
   Other proteins in same PDB: d1r9na2, d1r9nb2, d1r9nb3, d1r9nc2, d1r9nd2
   automatically matched to d1orva1
   complexed with nag

Details for d1r9nd1

PDB Entry: 1r9n, 2.3 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv in complex with a decapeptide (tnpy) at 2.3 ang. resolution

PDB Compounds: (D:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1r9nd1:

Sequence; same for both SEQRES and ATOM records:

>d1r9nd1 b.70.3.1 (D:40-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d1r9nd1:

• d1r9nd1 first appeared in SCOP 1.73
  
• d1r9nd1 appears in SCOPe 2.07