SCOPe 2.08: Domain d1r9nc2: 1r9n C:509-766

Lineage for d1r9nc2 (1r9n C:509-766)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller
   automatically mapped to Pfam PF00326

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82499] (58 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d1r9nc2: 1r9n C:509-766 [118750]
   Other proteins in same PDB: d1r9na1, d1r9nb1, d1r9nb3, d1r9nc1, d1r9nd1
   automatically matched to d1orva2
   complexed with nag

Details for d1r9nc2

PDB Entry: 1r9n, 2.3 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv in complex with a decapeptide (tnpy) at 2.3 ang. resolution

PDB Compounds: (C:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1r9nc2:

Sequence; same for both SEQRES and ATOM records:

>d1r9nc2 c.69.1.24 (C:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d1r9nc2:

• d1r9nc2 first appeared in SCOP 1.73
  
• d1r9nc2 appears in SCOPe 2.07