Lineage for d1r9nb1 (1r9n B:39-508)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066579Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2066692Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2066693Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 protein domains)
    Pfam PF00930
  6. 2066700Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 2066701Species Human (Homo sapiens) [TaxId:9606] [82174] (93 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2066785Domain d1r9nb1: 1r9n B:39-508 [118747]
    Other proteins in same PDB: d1r9na2, d1r9nb2, d1r9nb3, d1r9nc2, d1r9nd2
    automatically matched to d1orva1
    complexed with nag

Details for d1r9nb1

PDB Entry: 1r9n (more details), 2.3 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv in complex with a decapeptide (tnpy) at 2.3 ang. resolution
PDB Compounds: (B:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1r9nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9nb1 b.70.3.1 (B:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d1r9nb1:

Click to download the PDB-style file with coordinates for d1r9nb1.
(The format of our PDB-style files is described here.)

Timeline for d1r9nb1: