![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein Xylanase [51488] (6 species) |
![]() | Species Bacillus stearothermophilus, Xt6 [TaxId:1422] [69386] (8 PDB entries) Uniprot P40943 |
![]() | Domain d1r86a1: 1r86 A:9-379 [118744] complexed with cl, so4, zn; mutant |
PDB Entry: 1r86 (more details), 1.8 Å
SCOPe Domain Sequences for d1r86a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r86a1 c.1.8.3 (A:9-379) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} kphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenvmkpisiqp eegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnetdpvkreqn kqlllkrlethiktiverykddikywdvvnavvgddgklrnspwyqiagidyikvafqaa rkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqigwpseaeie ktinmfaalgldnqitaldvsmygwpprayptydaipkqkfldqaarydrlfklyeklsd kisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapfvfgpdykv kpaywaiidhk
Timeline for d1r86a1: