Lineage for d1r86a1 (1r86 A:9-379)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439765Protein Xylanase [51488] (6 species)
  7. 2439781Species Bacillus stearothermophilus, Xt6 [TaxId:1422] [69386] (8 PDB entries)
    Uniprot P40943
  8. 2439785Domain d1r86a1: 1r86 A:9-379 [118744]
    complexed with cl, so4, zn; mutant

Details for d1r86a1

PDB Entry: 1r86 (more details), 1.8 Å

PDB Description: crystal structure of the extracellular xylanase from geobacillus stearothermophilus t-6 (xt6, monoclinic form): the e159a/e265a mutant at 1.8a resolution
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d1r86a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r86a1 c.1.8.3 (A:9-379) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]}
kphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenvmkpisiqp
eegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnetdpvkreqn
kqlllkrlethiktiverykddikywdvvnavvgddgklrnspwyqiagidyikvafqaa
rkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqigwpseaeie
ktinmfaalgldnqitaldvsmygwpprayptydaipkqkfldqaarydrlfklyeklsd
kisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapfvfgpdykv
kpaywaiidhk

SCOPe Domain Coordinates for d1r86a1:

Click to download the PDB-style file with coordinates for d1r86a1.
(The format of our PDB-style files is described here.)

Timeline for d1r86a1: