SCOPe 2.07: Domain d1pula1: 1pul A:18-120

Lineage for d1pula1 (1pul A:18-120)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.11: p25-alpha [140538] (2 proteins)
   Pfam PF05517; comprises two degenerate EF-hands and extra C-terminal helix, packed agains the bundle end

6. Protein Hypothetical protein c32e8.3 [140539] (1 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [140540] (1 PDB entry)
   Uniprot P91127 8-110

8. Domain d1pula1: 1pul A:18-120 [118730]

Details for d1pula1

PDB Entry: 1pul

PDB Description: solution structure for the 21kda caenorhabditis elegans protein ce32e8.3. northeast structural genomics consortium target wr33

PDB Compounds: (A:) Hypothetical protein C32E8.3 in chromosome I

SCOPe Domain Sequences for d1pula1:

Sequence; same for both SEQRES and ATOM records:

>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
nwddadvkkrwdaftkfgaatatemtgknfdkwlkdagvldnkaitgtmtgiafskvtgp
kkkatfdetkkvlafvaedrarqskkpiqdeldaiteklakle

Timeline for d1pula1:

• d1pula1 first appeared in SCOP 1.73
  
• d1pula1 appears in SCOPe 2.06
  
• d1pula1 appears in the current release, SCOPe 2.08