Lineage for d1pula1 (1pul A:18-120)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711584Family a.39.1.11: p25-alpha [140538] (2 proteins)
    Pfam PF05517; comprises two degenerate EF-hands and extra C-terminal helix, packed agains the bundle end
  6. 2711585Protein Hypothetical protein c32e8.3 [140539] (1 species)
  7. 2711586Species Nematode (Caenorhabditis elegans) [TaxId:6239] [140540] (1 PDB entry)
    Uniprot P91127 8-110
  8. 2711587Domain d1pula1: 1pul A:18-120 [118730]

Details for d1pula1

PDB Entry: 1pul (more details)

PDB Description: solution structure for the 21kda caenorhabditis elegans protein ce32e8.3. northeast structural genomics consortium target wr33
PDB Compounds: (A:) Hypothetical protein C32E8.3 in chromosome I

SCOPe Domain Sequences for d1pula1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
nwddadvkkrwdaftkfgaatatemtgknfdkwlkdagvldnkaitgtmtgiafskvtgp
kkkatfdetkkvlafvaedrarqskkpiqdeldaiteklakle

SCOPe Domain Coordinates for d1pula1:

Click to download the PDB-style file with coordinates for d1pula1.
(The format of our PDB-style files is described here.)

Timeline for d1pula1: