Lineage for d1pkuj1 (1pku J:4-151)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861820Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 861821Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 861822Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 862010Species Rice(Oryza sativa) [TaxId:4530] [143285] (1 PDB entry)
    Uniprot Q07661 1-148
  8. 862020Domain d1pkuj1: 1pku J:4-151 [118727]
    automatically matched to 1PKU A:4-151

Details for d1pkuj1

PDB Entry: 1pku (more details), 2.5 Å

PDB Description: Crystal Structure of Nucleoside Diphosphate Kinase from Rice
PDB Compounds: (J:) Nucleoside Diphosphate Kinase I

SCOP Domain Sequences for d1pkuj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkuj1 d.58.6.1 (J:4-151) Nucleoside diphosphate kinase, NDK {Rice(Oryza sativa) [TaxId: 4530]}
meqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffpg
lveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsdsv
dngkkeialwfpeglaewrsnlhpwiye

SCOP Domain Coordinates for d1pkuj1:

Click to download the PDB-style file with coordinates for d1pkuj1.
(The format of our PDB-style files is described here.)

Timeline for d1pkuj1: