Lineage for d1pkui2 (1pku I:4-151)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. Protein automated matches [190032] (18 species)
    not a true protein
  7. Species Rice (Oryza sativa) [TaxId:4530] [186751] (1 PDB entry)
  8. Domain d1pkui2: 1pku I:4-151 [118726]
    Other proteins in same PDB: d1pkua1, d1pkua2, d1pkub3, d1pkuc3, d1pkud3, d1pkue3, d1pkuf3, d1pkug3, d1pkuh3, d1pkui3, d1pkuj3, d1pkuk3, d1pkul3
    automated match to d1u8wa_

Details for d1pkui2

PDB Entry: 1pku (more details), 2.5 Å

PDB Description: Crystal Structure of Nucleoside Diphosphate Kinase from Rice
PDB Compounds: (I:) Nucleoside Diphosphate Kinase I

SCOPe Domain Sequences for d1pkui2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkui2 d.58.6.1 (I:4-151) automated matches {Rice (Oryza sativa) [TaxId: 4530]}
meqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffpg
lveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsdsv
dngkkeialwfpeglaewrsnlhpwiye

SCOPe Domain Coordinates for d1pkui2 are not available.

Timeline for d1pkui2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pkui3