![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein) |
![]() | Protein Nucleoside diphosphate kinase, NDK [54921] (20 species) |
![]() | Species Rice(Oryza sativa) [TaxId:4530] [143285] (1 PDB entry) |
![]() | Domain d1pkue1: 1pku E:4-151 [118722] automatically matched to 1PKU A:4-151 |
PDB Entry: 1pku (more details), 2.5 Å
SCOP Domain Sequences for d1pkue1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pkue1 d.58.6.1 (E:4-151) Nucleoside diphosphate kinase, NDK {Rice(Oryza sativa) [TaxId: 4530]} meqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffpg lveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsdsv dngkkeialwfpeglaewrsnlhpwiye
Timeline for d1pkue1: