Lineage for d1pkub1 (1pku B:4-151)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724082Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 724083Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 724084Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 724260Species Rice(Oryza sativa) [TaxId:4530] [143285] (1 PDB entry)
  8. 724262Domain d1pkub1: 1pku B:4-151 [118719]
    automatically matched to 1PKU A:4-151

Details for d1pkub1

PDB Entry: 1pku (more details), 2.5 Å

PDB Description: Crystal Structure of Nucleoside Diphosphate Kinase from Rice
PDB Compounds: (B:) Nucleoside Diphosphate Kinase I

SCOP Domain Sequences for d1pkub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkub1 d.58.6.1 (B:4-151) Nucleoside diphosphate kinase, NDK {Rice(Oryza sativa) [TaxId: 4530]}
meqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffpg
lveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsdsv
dngkkeialwfpeglaewrsnlhpwiye

SCOP Domain Coordinates for d1pkub1:

Click to download the PDB-style file with coordinates for d1pkub1.
(The format of our PDB-style files is described here.)

Timeline for d1pkub1: