Lineage for d1pkua1 (1pku A:4-151)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518280Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2518281Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 2518282Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2518449Species Rice (Oryza sativa) [TaxId:4530] [143285] (1 PDB entry)
    Uniprot Q07661 1-148
  8. 2518450Domain d1pkua1: 1pku A:4-151 [118718]
    Other proteins in same PDB: d1pkua2, d1pkub2, d1pkub3, d1pkuc2, d1pkuc3, d1pkud2, d1pkud3, d1pkue2, d1pkue3, d1pkuf2, d1pkuf3, d1pkug2, d1pkug3, d1pkuh2, d1pkuh3, d1pkui2, d1pkui3, d1pkuj2, d1pkuj3, d1pkuk2, d1pkuk3, d1pkul2, d1pkul3

Details for d1pkua1

PDB Entry: 1pku (more details), 2.5 Å

PDB Description: Crystal Structure of Nucleoside Diphosphate Kinase from Rice
PDB Compounds: (A:) Nucleoside Diphosphate Kinase I

SCOPe Domain Sequences for d1pkua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkua1 d.58.6.1 (A:4-151) Nucleoside diphosphate kinase, NDK {Rice (Oryza sativa) [TaxId: 4530]}
meqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffpg
lveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsdsv
dngkkeialwfpeglaewrsnlhpwiye

SCOPe Domain Coordinates for d1pkua1:

Click to download the PDB-style file with coordinates for d1pkua1.
(The format of our PDB-style files is described here.)

Timeline for d1pkua1: