Lineage for d1pkua1 (1pku A:4-151)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. Species Rice (Oryza sativa) [TaxId:4530] [143285] (1 PDB entry)
    Uniprot Q07661 1-148
  8. Domain d1pkua1: 1pku A:4-151 [118718]
    Other proteins in same PDB: d1pkua2, d1pkub2, d1pkub3, d1pkuc2, d1pkuc3, d1pkud2, d1pkud3, d1pkue2, d1pkue3, d1pkuf2, d1pkuf3, d1pkug2, d1pkug3, d1pkuh2, d1pkuh3, d1pkui2, d1pkui3, d1pkuj2, d1pkuj3, d1pkuk2, d1pkuk3, d1pkul2, d1pkul3

Details for d1pkua1

PDB Entry: 1pku (more details), 2.5 Å

PDB Description: Crystal Structure of Nucleoside Diphosphate Kinase from Rice
PDB Compounds: (A:) Nucleoside Diphosphate Kinase I

SCOPe Domain Sequences for d1pkua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkua1 d.58.6.1 (A:4-151) Nucleoside diphosphate kinase, NDK {Rice (Oryza sativa) [TaxId: 4530]}
meqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffpg
lveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsdsv
dngkkeialwfpeglaewrsnlhpwiye

SCOPe Domain Coordinates for d1pkua1 are not available.

Timeline for d1pkua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pkua2