![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.0: automated matches [191306] (1 protein) not a true family |
![]() | Protein automated matches [190031] (3 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [186750] (3 PDB entries) |
![]() | Domain d1pk3b_: 1pk3 B: [118716] Other proteins in same PDB: d1pk3a1, d1pk3a2, d1pk3c3 automated match to d1kw4a_ complexed with bme |
PDB Entry: 1pk3 (more details), 1.85 Å
SCOPe Domain Sequences for d1pk3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pk3b_ a.60.1.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} qpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmkymglklgpalki cnlvnkvn
Timeline for d1pk3b_:
![]() Domains from other chains: (mouse over for more information) d1pk3a1, d1pk3a2, d1pk3c2, d1pk3c3 |