![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (3 families) ![]() |
![]() | Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (15 proteins) |
![]() | Protein Polycomb protein Scm [140620] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140621] (2 PDB entries) Uniprot Q9VHA0 795-871 |
![]() | Domain d1pk3a1: 1pk3 A:17-79 [118715] complexed with bme; mutant |
PDB Entry: 1pk3 (more details), 1.85 Å
SCOP Domain Sequences for d1pk3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pk3a1 a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} wtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmkymglklgpalkicnlv nkv
Timeline for d1pk3a1: