![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.0: automated matches [191306] (1 protein) not a true family |
![]() | Protein automated matches [190031] (3 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [186750] (3 PDB entries) |
![]() | Domain d1pk1d_: 1pk1 D: [118714] Other proteins in same PDB: d1pk1a1, d1pk1b1, d1pk1c_ automated match to d1kw4a_ |
PDB Entry: 1pk1 (more details), 1.8 Å
SCOPe Domain Sequences for d1pk1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pk1d_ a.60.1.0 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} pidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsermmkymglklgpalkic nlvnkvn
Timeline for d1pk1d_: