SCOPe 2.08: Domain d1pk1d_: 1pk1 D:

Lineage for d1pk1d_ (1pk1 D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [186750] (3 PDB entries)

8. Domain d1pk1d_: 1pk1 D: [118714]
   Other proteins in same PDB: d1pk1a1, d1pk1b1, d1pk1c_
   automated match to d1kw4a_

Details for d1pk1d_

PDB Entry: 1pk1, 1.8 Å

PDB Description: hetero sam domain structure of ph and scm.

PDB Compounds: (D:) Sex comb on midleg CG9495-PA

SCOPe Domain Sequences for d1pk1d_:

Sequence; same for both SEQRES and ATOM records:

>d1pk1d_ a.60.1.0 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsermmkymglklgpalkic
nlvnkvn

Timeline for d1pk1d_:

• d1pk1d_ first appeared in SCOP 1.73, called d1pk1d1
  
• d1pk1d_ appears in SCOPe 2.07