SCOPe 2.08: Domain d1pk1c_: 1pk1 C:

Lineage for d1pk1c_ (1pk1 C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)

6. Protein Polyhomeotic [74737] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [74738] (2 PDB entries)

8. Domain d1pk1c_: 1pk1 C: [118713]
   Other proteins in same PDB: d1pk1b1, d1pk1d_
   automated match to d1kw4a_

Details for d1pk1c_

PDB Entry: 1pk1, 1.8 Å

PDB Description: hetero sam domain structure of ph and scm.

PDB Compounds: (C:) Polyhomeotic-proximal chromatin protein

SCOPe Domain Sequences for d1pk1c_:

Sequence; same for both SEQRES and ATOM records:

>d1pk1c_ a.60.1.2 (C:) Polyhomeotic {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pisswsvddvsnfirelpgcqdyvddfiqqeidgqallllkekhlvnamgmklgparkiv
akvesi

Timeline for d1pk1c_:

• d1pk1c_ first appeared in SCOP 1.73, called d1pk1c1
  
• d1pk1c_ appears in SCOPe 2.07