Lineage for d1pk1a1 (1pk1 A:12-79)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1998616Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1998661Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 protein domains)
  6. 1998698Protein Polyhomeotic [74737] (1 species)
  7. 1998699Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [74738] (2 PDB entries)
  8. 1998701Domain d1pk1a1: 1pk1 A:12-79 [118711]
    Other proteins in same PDB: d1pk1b1, d1pk1d_

Details for d1pk1a1

PDB Entry: 1pk1 (more details), 1.8 Å

PDB Description: Hetero SAM domain structure of Ph and Scm.
PDB Compounds: (A:) Polyhomeotic-proximal chromatin protein

SCOPe Domain Sequences for d1pk1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pk1a1 a.60.1.2 (A:12-79) Polyhomeotic {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ppisswsvddvsnfirelpgcqdyvddfiqqeidgqallllkekhlvnamgmklgparki
vakvesik

SCOPe Domain Coordinates for d1pk1a1:

Click to download the PDB-style file with coordinates for d1pk1a1.
(The format of our PDB-style files is described here.)

Timeline for d1pk1a1: