Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) |
Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
Protein Polyhomeotic [74737] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [74738] (2 PDB entries) |
Domain d1pk1a1: 1pk1 A:12-79 [118711] Other proteins in same PDB: d1pk1b1, d1pk1d_ |
PDB Entry: 1pk1 (more details), 1.8 Å
SCOPe Domain Sequences for d1pk1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pk1a1 a.60.1.2 (A:12-79) Polyhomeotic {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} ppisswsvddvsnfirelpgcqdyvddfiqqeidgqallllkekhlvnamgmklgparki vakvesik
Timeline for d1pk1a1: