SCOPe 2.07: Domain d1ohsb_: 1ohs B:

Lineage for d1ohsb_ (1ohs B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
   automatically mapped to Pfam PF12680
   automatically mapped to Pfam PF02136

6. Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)

7. Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (23 PDB entries)

8. Domain d1ohsb_: 1ohs B: [118707]
   automated match to d1qjga_
   complexed with 5sd; mutant

Details for d1ohsb_

PDB Entry: 1ohs, 1.7 Å

PDB Description: crystal structure of 5-3-ketosteroid isomerase mutant y14f/ d38n from pseudomonas testosteroni complexed with androstanedione

PDB Compounds: (B:) steroid delta-isomerase

SCOPe Domain Sequences for d1ohsb_:

Sequence; same for both SEQRES and ATOM records:

>d1ohsb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}
mntpehmtavvqrfvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
ihaga

Timeline for d1ohsb_:

• d1ohsb_ first appeared in SCOP 1.73, called d1ohsb1
  
• d1ohsb_ appears in SCOPe 2.06
  
• d1ohsb_ appears in the current release, SCOPe 2.08