SCOPe 2.05: Domain d1ohpc_: 1ohp C:

Lineage for d1ohpc_ (1ohp C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
   automatically mapped to Pfam PF12680
   automatically mapped to Pfam PF02136

6. Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)

7. Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (21 PDB entries)

8. Domain d1ohpc_: 1ohp C: [118704]
   automated match to d1qjga_
   complexed with esr; mutant

Details for d1ohpc_

PDB Entry: 1ohp, 1.53 Å

PDB Description: crystal structure of 5-3-ketosteroid isomerase mutant d38n from pseudomonas testosteroni complexed with 5alpha-estran-3,17-dione

PDB Compounds: (C:) steroid delta-isomerase

SCOPe Domain Sequences for d1ohpc_:

Sequence; same for both SEQRES and ATOM records:

>d1ohpc_ d.17.4.3 (C:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}
mntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
ihaga

Timeline for d1ohpc_:

• d1ohpc_ first appeared in SCOP 1.73, called d1ohpc1
  
• d1ohpc_ appears in SCOPe 2.04
  
• d1ohpc_ appears in SCOPe 2.06
  
• d1ohpc_ appears in the current release, SCOPe 2.08