SCOP 1.73: Domain d1ohpb1: 1ohp B:201-325

Lineage for d1ohpb1 (1ohp B:201-325)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (13 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)

6. Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)

7. Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (8 PDB entries)

8. Domain d1ohpb1: 1ohp B:201-325 [118703]
   automatically matched to d8cho__
   complexed with esr; mutant

Details for d1ohpb1

PDB Entry: 1ohp, 1.53 Å

PDB Description: crystal structure of 5-3-ketosteroid isomerase mutant d38n from pseudomonas testosteroni complexed with 5alpha-estran-3,17-dione

PDB Compounds: (B:) steroid delta-isomerase

SCOP Domain Sequences for d1ohpb1:

Sequence; same for both SEQRES and ATOM records:

>d1ohpb1 d.17.4.3 (B:201-325) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}
mntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
ihaga

Timeline for d1ohpb1:

• d1ohpb1 is new in SCOP 1.73
  
• d1ohpb1 appears in SCOP 1.75
  
• d1ohpb1 appears in the current release, SCOPe 2.08, called d1ohpb_