Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (13 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins) |
Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species) |
Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (8 PDB entries) |
Domain d1ohpa1: 1ohp A:1-125 [118702] automatically matched to d8cho__ complexed with esr; mutant |
PDB Entry: 1ohp (more details), 1.53 Å
SCOP Domain Sequences for d1ohpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} mntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn ihaga
Timeline for d1ohpa1: