Lineage for d1ohpa1 (1ohp A:1-125)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 718985Superfamily d.17.4: NTF2-like [54427] (13 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 719067Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)
  6. 719068Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 719069Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (8 PDB entries)
  8. 719070Domain d1ohpa1: 1ohp A:1-125 [118702]
    automatically matched to d8cho__
    complexed with esr; mutant

Details for d1ohpa1

PDB Entry: 1ohp (more details), 1.53 Å

PDB Description: crystal structure of 5-3-ketosteroid isomerase mutant d38n from pseudomonas testosteroni complexed with 5alpha-estran-3,17-dione
PDB Compounds: (A:) steroid delta-isomerase

SCOP Domain Sequences for d1ohpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}
mntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
ihaga

SCOP Domain Coordinates for d1ohpa1:

Click to download the PDB-style file with coordinates for d1ohpa1.
(The format of our PDB-style files is described here.)

Timeline for d1ohpa1: