Lineage for d1ob5e3 (1ob5 E:9-212)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830208Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 830239Species Thermus thermophilus [TaxId:274] [52629] (7 PDB entries)
  8. 830251Domain d1ob5e3: 1ob5 E:9-212 [118699]
    Other proteins in same PDB: d1ob5a1, d1ob5a2, d1ob5c1, d1ob5c2, d1ob5e1, d1ob5e2
    automatically matched to d1aipa3
    complexed with 2mg, 5mc, 5mu, 7mg, c, enx, gnp, h2u, m2g, mad, mg, omc, omg, pha, psu, yg

Details for d1ob5e3

PDB Entry: 1ob5 (more details), 3.1 Å

PDB Description: t. aquaticus elongation factor ef-tu complexed with the antibiotic enacyloxin iia, a gtp analog, and phe-trna
PDB Compounds: (E:) elongation factor tu

SCOP Domain Sequences for d1ob5e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ob5e3 c.37.1.8 (E:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv
eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhknpkt
krgenewvdkiwelldaideyipt

SCOP Domain Coordinates for d1ob5e3:

Click to download the PDB-style file with coordinates for d1ob5e3.
(The format of our PDB-style files is described here.)

Timeline for d1ob5e3: