Lineage for d1ob5e1 (1ob5 E:213-312)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2402557Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2402871Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2402872Protein automated matches [226946] (29 species)
    not a true protein
  7. Species Thermus aquaticus [TaxId:271] [254881] (1 PDB entry)
  8. 2403018Domain d1ob5e1: 1ob5 E:213-312 [118697]
    Other proteins in same PDB: d1ob5a2, d1ob5a3, d1ob5c2, d1ob5c3, d1ob5e2, d1ob5e3
    automated match to d1b23p1
    protein/RNA complex; complexed with enx, gnp, mg

Details for d1ob5e1

PDB Entry: 1ob5 (more details), 3.1 Å

PDB Description: t. aquaticus elongation factor ef-tu complexed with the antibiotic enacyloxin iia, a gtp analog, and phe-trna
PDB Compounds: (E:) elongation factor tu

SCOPe Domain Sequences for d1ob5e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ob5e1 b.43.3.0 (E:213-312) automated matches {Thermus aquaticus [TaxId: 271]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitp

SCOPe Domain Coordinates for d1ob5e1:

Click to download the PDB-style file with coordinates for d1ob5e1.
(The format of our PDB-style files is described here.)

Timeline for d1ob5e1: