Lineage for d1ob5e1 (1ob5 E:213-312)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801216Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801236Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 801237Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 801311Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 801340Species Thermus thermophilus [TaxId:274] [50452] (7 PDB entries)
  8. 801352Domain d1ob5e1: 1ob5 E:213-312 [118697]
    Other proteins in same PDB: d1ob5a2, d1ob5a3, d1ob5c2, d1ob5c3, d1ob5e2, d1ob5e3
    automatically matched to d1aipa1
    complexed with 2mg, 5mc, 5mu, 7mg, c, enx, gnp, h2u, m2g, mad, mg, omc, omg, pha, psu, yg

Details for d1ob5e1

PDB Entry: 1ob5 (more details), 3.1 Å

PDB Description: t. aquaticus elongation factor ef-tu complexed with the antibiotic enacyloxin iia, a gtp analog, and phe-trna
PDB Compounds: (E:) elongation factor tu

SCOP Domain Sequences for d1ob5e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ob5e1 b.43.3.1 (E:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitp

SCOP Domain Coordinates for d1ob5e1:

Click to download the PDB-style file with coordinates for d1ob5e1.
(The format of our PDB-style files is described here.)

Timeline for d1ob5e1: