Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (29 species) not a true protein |
Domain d1ob5e1: 1ob5 E:213-312 [118697] Other proteins in same PDB: d1ob5a2, d1ob5a3, d1ob5c2, d1ob5c3, d1ob5e2, d1ob5e3 automated match to d1b23p1 protein/RNA complex; complexed with enx, gnp, mg |
PDB Entry: 1ob5 (more details), 3.1 Å
SCOPe Domain Sequences for d1ob5e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ob5e1 b.43.3.0 (E:213-312) automated matches {Thermus aquaticus [TaxId: 271]} pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem hrktlqegiagdnvglllrgvsreevergqvlakpgsitp
Timeline for d1ob5e1: