Lineage for d1ob5c3 (1ob5 C:6-212)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2476142Protein automated matches [190047] (34 species)
    not a true protein
  7. 2476902Species Thermus aquaticus [TaxId:271] [254880] (1 PDB entry)
  8. 2476904Domain d1ob5c3: 1ob5 C:6-212 [118696]
    Other proteins in same PDB: d1ob5a1, d1ob5a2, d1ob5c1, d1ob5c2, d1ob5e1, d1ob5e2
    automated match to d1b23p3
    protein/RNA complex; complexed with enx, gnp, mg

Details for d1ob5c3

PDB Entry: 1ob5 (more details), 3.1 Å

PDB Description: t. aquaticus elongation factor ef-tu complexed with the antibiotic enacyloxin iia, a gtp analog, and phe-trna
PDB Compounds: (C:) elongation factor tu

SCOPe Domain Sequences for d1ob5c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ob5c3 c.37.1.8 (C:6-212) automated matches {Thermus aquaticus [TaxId: 271]}
irtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitint
ahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarq
vgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhkn
pktkrgenewvdkiwelldaideyipt

SCOPe Domain Coordinates for d1ob5c3:

Click to download the PDB-style file with coordinates for d1ob5c3.
(The format of our PDB-style files is described here.)

Timeline for d1ob5c3: