![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [52629] (7 PDB entries) |
![]() | Domain d1ob5c3: 1ob5 C:9-212 [118696] Other proteins in same PDB: d1ob5a1, d1ob5a2, d1ob5c1, d1ob5c2, d1ob5e1, d1ob5e2 automatically matched to d1aipa3 complexed with 2mg, 5mc, 5mu, 7mg, c, enx, gnp, h2u, m2g, mad, mg, omc, omg, pha, psu, yg |
PDB Entry: 1ob5 (more details), 3.1 Å
SCOP Domain Sequences for d1ob5c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ob5c3 c.37.1.8 (C:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhknpkt krgenewvdkiwelldaideyipt
Timeline for d1ob5c3: