| Class b: All beta proteins [48724] (165 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
| Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
| Species Thermus thermophilus [TaxId:274] [50470] (7 PDB entries) |
| Domain d1ob5c2: 1ob5 C:313-405 [118695] Other proteins in same PDB: d1ob5a1, d1ob5a3, d1ob5c1, d1ob5c3, d1ob5e1, d1ob5e3 automatically matched to d1aipa2 complexed with 2mg, 5mc, 5mu, 7mg, c, enx, gnp, h2u, m2g, mad, mg, omc, omg, pha, psu, yg |
PDB Entry: 1ob5 (more details), 3.1 Å
SCOP Domain Sequences for d1ob5c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ob5c2 b.44.1.1 (C:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]}
htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile
Timeline for d1ob5c2: