![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) ![]() |
![]() | Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins) |
![]() | Protein Galectin-3 CRD [49940] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49941] (6 PDB entries) |
![]() | Domain d1kjra1: 1kjr A:114-250 [118690] automatically matched to d1a3k__ complexed with bek, cl, gal, nag |
PDB Entry: 1kjr (more details), 1.55 Å
SCOP Domain Sequences for d1kjra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kjra1 b.29.1.3 (A:114-250) Galectin-3 CRD {Human (Homo sapiens) [TaxId: 9606]} livpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrvivc ntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneisk lgisgdidltsasytmi
Timeline for d1kjra1: